Keep my session open?
Ending In 
The session is expired
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Due to maintenance activity, Global web site will not be available from 6AM till 1 PM ET on 24th August 2024

  • Product Results
  • Produktkategorie
  • Kriterien
  • Lieferant
  • Lieferant auswählen
    Sort by:

  • Aktionsprodukte
  • Suche in Ergebnissen

Sie suchten nach:

ATAGO


135 298  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"135298"
  Listenansicht Searching Easy View Hybridansicht
Sortieren nach:
 
 
 
 

Lieferant:  COMBI-BLOCKS
Beschreibung:   1-(2-Chlorphenyl)-1H-pyrazol-4-boronsäure
Lieferant:  Columbia Biosciences
Hersteller-Artikelnummer:: D3-1866-50
Lokale Artikelnummer:: COBSD3-1866-50
Beschreibung:   Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
VE:  1 * 50 µG
Lieferant:  VWR Chemicals
Lokale Artikelnummer:: VWRC1B1509-25G
Beschreibung:   DNA, salt, from fish sperm is an effective blocking agent used to increase signal-to-noise ratio for detection during hybridisation.
VE:  1 * 25 g
Lieferant:  LABCONCO
Beschreibung:   These cabinets support fume hoods and safely store and vent acids and also other corrosive liquids.
Lieferant:  Bioss
Hersteller-Artikelnummer:: BS-11940R-A680
Lokale Artikelnummer:: BOSSBS-11940R-A680
Beschreibung:   Retinoic acid induced 1 (RAI1) is a 1906 amino acid protein containing an N-terminal polyglutamine stretch that is expressed in most tissues, with highest expression in neuronal tissues. RAI1 functions as a transcriptional regulator and is important for embryonic and postnatal developments. Heterozygous deletions of the RAI1 gene are associated with Smith-Magenis syndrome (SMS), a mental retardation syndrome with behavioural, neurological and skeletal anomalies. Individuals affected with SMS usually display self-injurious behaviors, sleep disturbance, developmental delay and reduced motor and cognitive skills. RAI1 haploinsufficiency is specifically responsible for the obesity and craniofacial symptoms of SMS. RAI1 mutations have also been implicated in schizophrenia and spinocerebellar ataxia type 2.
VE:  1 * 100 µl
Lieferant:  Bioss
Hersteller-Artikelnummer:: BS-11940R-A750
Lokale Artikelnummer:: BOSSBS-11940R-A750
Beschreibung:   Retinoic acid induced 1 (RAI1) is a 1906 amino acid protein containing an N-terminal polyglutamine stretch that is expressed in most tissues, with highest expression in neuronal tissues. RAI1 functions as a transcriptional regulator and is important for embryonic and postnatal developments. Heterozygous deletions of the RAI1 gene are associated with Smith-Magenis syndrome (SMS), a mental retardation syndrome with behavioural, neurological and skeletal anomalies. Individuals affected with SMS usually display self-injurious behaviors, sleep disturbance, developmental delay and reduced motor and cognitive skills. RAI1 haploinsufficiency is specifically responsible for the obesity and craniofacial symptoms of SMS. RAI1 mutations have also been implicated in schizophrenia and spinocerebellar ataxia type 2.
VE:  1 * 100 µl
Artikel-Nr: (SAMP8010M-1)

Lieferant:  Sampling Systems
Hersteller-Artikelnummer:: 8010M-1
Lokale Artikelnummer:: SAMP8010M-1
Beschreibung:   Beutelclips sind für das einfache Verschließen und Versiegeln von Beuteln konzipiert.
VE:  1 * 10 ST
Lieferant:  MACHEREY-NAGEL
Beschreibung:   QUANTOFIX® test strips meet all requirements of a modern rapid test. The colour of the reactive pad changes depending on the concentration of an analyte in the sample. The evaluation is usually carried out visually by comparison of the reaction colour with a multi-stage colour scale. These test strips are immediately ready-to-use. They do not require additional accessories. The test strips are intended for single use, maintenance or calibration are not required.
Lieferant:  VWR Collection
Beschreibung:   Kunststoff-Pufferflasche, 1 l, Für: Amino acid analyser, L-8900
Lieferant:  Avantor Fluid Handling
Beschreibung:   Kein Rosten, Korrodieren oder Verformen.
Lieferant:  US Biological
Hersteller-Artikelnummer:: F0019-76L5
Lokale Artikelnummer:: USBIF0019-76L5
Beschreibung:   Anti-Fatty Acid Binding Protein, Heart Mouse monoclonal antibody [clone: 12H25]
VE:  1 * 1 mg
Lieferant:  US Biological
Hersteller-Artikelnummer:: 152107
Lokale Artikelnummer:: USBI152107
Beschreibung:   Anti-Sialic Acid Binding Ig Like Lectin 9 Mouse Monoclonal Antibody
VE:  1 * 200 µG
Lieferant:  ProSci Inc.
Hersteller-Artikelnummer:: 3125P
Lokale Artikelnummer:: PRSI3125P
Beschreibung:   IRAK4 peptide is used for blocking the activity of IRAK-4 antibody.
VE:  1 * 50 µG
Lieferant:  Biosensis
Hersteller-Artikelnummer:: M-1375-100
Lokale Artikelnummer:: BSENM-1375-100
Beschreibung:   GFAP is a 50 kDa intra-cytoplasmic filamentous protein of the cytoskeleton in astrocytes. During the development of the central nervous system, it is a cell-specific marker that distinguishes astrocytes from other glial cells. GFAP immunoreactivity has been shown in immature oligodendrocytes, epiglottic cartilage, pituicytes, papillary meningiomas, myoepithelial cells of the breast and in non-CNS: Schwann cells, salivary gland neoplasms, enteric glia cells, and metastasizing renal carcinomas.
VE:  1 * 100 µl
Lieferant:  US Biological
Hersteller-Artikelnummer:: 131865
Lokale Artikelnummer:: USBI131865
Beschreibung:   Anti-Prostatic Acid Phosphatase Mouse Polyclonal Antibody
VE:  1 * 50 µG
Lieferant:  Bioss
Hersteller-Artikelnummer:: BS-6852R-A680
Lokale Artikelnummer:: BOSSBS-6852R-A680
Beschreibung:   Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
VE:  1 * 100 µl
Preis auf Anfrage
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Dieses Produkt kann nur an eine Lieferadresse versandt werden die über die entsprechende Lizenzen verfügt. Für weitere Hilfe bitte kontaktieren Sie Ihr VWR Vertriebszentrum.
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
Dieses Produkt wurde von Ihrer Organisation gesperrt. Bitte kontaktieren Sie Ihren Einkauf für weitere Informationen.
Dieses Produkt ist Ersatz für den von Ihnen gewünschten Artikel.
Dieses Produkt ist nicht mehr verfügbar. Bitte kontaktieren Sie den VWR Kundenservice.
14 945 - 14 960  von 135 298