Keep my session open?
Ending In 
The session is expired
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Due to maintenance activity, Global web site will not be available from 6AM till 1 PM ET on 24th August 2024

  • Product Results
  • Produktkategorie
  • Kriterien
  • Lieferant
  • Lieferant auswählen
    Sort by:

  • Aktionsprodukte
  • Suche in Ergebnissen

Sie suchten nach:

2-Fluoro-3-methoxybenzoic+acid


142 899  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"142899"
  Listenansicht Searching Easy View Hybridansicht
Sortieren nach:
 
 
 
 

Lieferant:  Restek
Hersteller-Artikelnummer:: 32444
Lokale Artikelnummer:: REST32444
Beschreibung:   Mix contains Acifluorfen methyl ester, Bentazon methyl ester, Chloramben methyl ester, Dalapon methyl ester, 2,4-D methyl ester, 2,4-DB methyl ester, DCPA methyl ester (Chlorthal-dimethyl), Dicamba methyl ester, 3,5-Dichlorobenzoic acid methyl ester, Dichlorprop methyl ester, Dinoseb methyl ether, Pentachloroanisole, Picloram methyl ester, Quinclorac methyl ester, 2,4,5-T methyl ester, 2,4,5-TP.
VE:  1 * 1 mL
Lieferant:  Thermo Scientific
Beschreibung:   3-(2-Chlor-6-fluorphenyl)-5-methyl-4-isoxazolcarbonsäure
Lieferant:  COMBI-BLOCKS
Beschreibung:   6,7-Dichlor-3-(trifluormethyl)-2-chinoxalincarbonsäure
Artikel-Nr: (CHMPFL9925.POR)

Lieferant:  CHEMPUR
Hersteller-Artikelnummer:: FL9925.POR
Lokale Artikelnummer:: CHMPFL9925.POR
Beschreibung:   2,4-Dimethyl-5-thiazolcarbonsäureamid
VE:  1 * 1 ST
Artikel-Nr: (MAYBGK02804.10)

Lieferant:  Thermo Scientific
Hersteller-Artikelnummer:: GK02804.10
Lokale Artikelnummer:: MAYBGK02804.10
Beschreibung:   3-Amino-1H-pyrazol-4-carbonsäure
VE:  1 * 10 g
Market Source Item This is a MarketSource item. Additional charges may apply
Artikel-Nr: (COBBBB-9020-1G)

Lieferant:  COMBI-BLOCKS
Hersteller-Artikelnummer:: BB-9020-1G
Lokale Artikelnummer:: COBBBB-9020-1G
Beschreibung:   1-Methyl-1H-indazol-5-boronsäure
VE:  1 * 1 g
Market Source Item This is a MarketSource item. Additional charges may apply
Lieferant:  Thermo Scientific
Beschreibung:   3-(2,6-Dichlorphenyl)-5-methyl-4-isoxazolcarbonsäure
Lieferant:  Sigma-Aldrich
Hersteller-Artikelnummer:: 48047
Lokale Artikelnummer:: SUPL48047
Beschreibung:   EPA 552 Halogenated Acetic Acids Mix, Supelco®, Certified reference material, 2000 mug/mL each component in methyl tert-butyl ether, : N/A
VE:  1 * 1 ST
Lieferant:  COMBI-BLOCKS
Beschreibung:   4-Hydroxy-8-(trifluormethyl)-3-chinolincarbonsäure
Artikel-Nr: (MAYBCC18401.250)

Lieferant:  Thermo Scientific
Hersteller-Artikelnummer:: CC18401.250
Lokale Artikelnummer:: MAYBCC18401.250
Beschreibung:   4-(1H-Pyrazol-1-yl)benzoesäure
VE:  1 * 250 mg
Market Source Item This is a MarketSource item. Additional charges may apply
Lieferant:  Columbia Biosciences
Hersteller-Artikelnummer:: D3-1866-50
Lokale Artikelnummer:: COBSD3-1866-50
Beschreibung:   Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
VE:  1 * 50 µG
Lieferant:  COMBI-BLOCKS
Beschreibung:   1-(2-Chlorphenyl)-1H-pyrazol-4-boronsäure
Lieferant:  VWR Chemicals
Lokale Artikelnummer:: VWRC1B1509-25G
Beschreibung:   DNA, salt, from fish sperm is an effective blocking agent used to increase signal-to-noise ratio for detection during hybridisation.
VE:  1 * 25 g
Lieferant:  Bioss
Hersteller-Artikelnummer:: BS-11940R-A680
Lokale Artikelnummer:: BOSSBS-11940R-A680
Beschreibung:   Retinoic acid induced 1 (RAI1) is a 1906 amino acid protein containing an N-terminal polyglutamine stretch that is expressed in most tissues, with highest expression in neuronal tissues. RAI1 functions as a transcriptional regulator and is important for embryonic and postnatal developments. Heterozygous deletions of the RAI1 gene are associated with Smith-Magenis syndrome (SMS), a mental retardation syndrome with behavioural, neurological and skeletal anomalies. Individuals affected with SMS usually display self-injurious behaviors, sleep disturbance, developmental delay and reduced motor and cognitive skills. RAI1 haploinsufficiency is specifically responsible for the obesity and craniofacial symptoms of SMS. RAI1 mutations have also been implicated in schizophrenia and spinocerebellar ataxia type 2.
VE:  1 * 100 µl
Lieferant:  Bioss
Hersteller-Artikelnummer:: BS-11940R-A750
Lokale Artikelnummer:: BOSSBS-11940R-A750
Beschreibung:   Retinoic acid induced 1 (RAI1) is a 1906 amino acid protein containing an N-terminal polyglutamine stretch that is expressed in most tissues, with highest expression in neuronal tissues. RAI1 functions as a transcriptional regulator and is important for embryonic and postnatal developments. Heterozygous deletions of the RAI1 gene are associated with Smith-Magenis syndrome (SMS), a mental retardation syndrome with behavioural, neurological and skeletal anomalies. Individuals affected with SMS usually display self-injurious behaviors, sleep disturbance, developmental delay and reduced motor and cognitive skills. RAI1 haploinsufficiency is specifically responsible for the obesity and craniofacial symptoms of SMS. RAI1 mutations have also been implicated in schizophrenia and spinocerebellar ataxia type 2.
VE:  1 * 100 µl
Lieferant:  LABCONCO
Beschreibung:   These cabinets support fume hoods and safely store and vent acids and also other corrosive liquids.
Preis auf Anfrage
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Dieses Produkt kann nur an eine Lieferadresse versandt werden die über die entsprechende Lizenzen verfügt. Für weitere Hilfe bitte kontaktieren Sie Ihr VWR Vertriebszentrum.
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
Dieses Produkt wurde von Ihrer Organisation gesperrt. Bitte kontaktieren Sie Ihren Einkauf für weitere Informationen.
Dieses Produkt ist Ersatz für den von Ihnen gewünschten Artikel.
Dieses Produkt ist nicht mehr verfügbar. Bitte kontaktieren Sie den VWR Kundenservice.
14 977 - 14 992  von 142 899