Keep my session open?
Ending In 
The session is expired
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Due to maintenance activity, Global web site will not be available from 6AM till 1 PM ET on 24th August 2024

  • Product Results
  • Produktkategorie
  • Kriterien
  • Lieferant
  • Lieferant auswählen
    Sort by:

  • Aktionsprodukte
  • Suche in Ergebnissen

Sie suchten nach:

22-(tert-Butoxy)-22-oxodocosanoic+acid


174 131  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"174131"
  Listenansicht Searching Easy View Hybridansicht
Sortieren nach:
 
 
 
 

Lieferant:  APOLLO SCIENTIFIC
Beschreibung:   5-(Trifluormethyl)anthranilsäure 97%
Lieferant:  Biotium
Hersteller-Artikelnummer:: 90010
Lokale Artikelnummer:: BTIU90010
Beschreibung:   ANTS (8-aminonaphthalene-1,3,6-trisulfonic acid, disodium salt) is a highly negatively charged dye with an amino group that can be coupled to an aldehyde or ketone group to form an unstable Schiff base. The Schiff base is usually chemically reduced by sodium borohydride (NaBH4) or sodium cyanoborohydride (NaB(CN)H3) to form a stable linkage. This labeling technique has been widely used for the labeling and subsequent sequencing of oligosaccharides and glycoproteins. The negative charges of the dye facilitate the electrophoretic separation of the degradation products of carbohydrate polymers.
VE:  1 * 500 mg
Lieferant:  Columbia Biosciences
Hersteller-Artikelnummer:: D3-1866-50
Lokale Artikelnummer:: COBSD3-1866-50
Beschreibung:   Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
VE:  1 * 50 µG
Lieferant:  Alfa Aesar
Beschreibung:   L(+)-Asparaginsäure ≥99% metallarm
Lieferant:  EHRENSTORFER
Hersteller-Artikelnummer:: YA10713000MB
Lokale Artikelnummer:: EHERYA10713000MB
Beschreibung:   Organic Standard, Bromchloressigsäure 1.000 µg/ml in tert-Butylmethylether, Packung: Glasflasche
VE:  1 * 1 mL
Lieferant:  EHRENSTORFER
Hersteller-Artikelnummer:: YA12216000MB
Lokale Artikelnummer:: EHERYA12216000MB
Beschreibung:   Organic Standard, Dibromessigsäure 1.000 µg/ml in tert-Butylmethylether, Packung: Glasflasche
VE:  1 * 1 mL
Lieferant:  APOLLO SCIENTIFIC
Beschreibung:   2-Aminoisobuttersäure
Lieferant:  Alfa Aesar
Beschreibung:   Ethyl-2-amino-5,6-dihydro-4H-cyclopenta[b]thiophene-3-carboxylate 96%
Lieferant:  Alfa Aesar
Beschreibung:   2-Aminoisobuttersäure 99%
Lieferant:  APOLLO SCIENTIFIC
Beschreibung:   3-Bromanthranilsäure 97%
Lieferant:  Thermo Scientific
Beschreibung:   4-Nitroanthranilsäure 97%
Lieferant:  Thermo Scientific
Beschreibung:   2-Aminoisonicotinsäure 97%
Artikel-Nr: (C8679-25G)

Lieferant:  SIGMA ALDRICH MICROSCOPY
Hersteller-Artikelnummer:: C8679-25G
Lokale Artikelnummer:: SIAMC8679-25G
Beschreibung:   Chicago Sky Blue 6B is a counterstain for background autofluorescence in fluorescence and immunofluorescence histochemistry. It has also been used as a filling in glass pipette electrodes for electrophysiological recordings in the brain sections of rats.
VE:  1 * 25 g
Lieferant:  Alfa Aesar
Beschreibung:   5-Fluoranthranilsäure ≥98%
Lieferant:  APOLLO SCIENTIFIC
Beschreibung:   2,4-Difluoro-DL-phenylglycine 98%
Artikel-Nr: (APOSOR28120-1G)

Lieferant:  APOLLO SCIENTIFIC
Hersteller-Artikelnummer:: OR28120-1G
Lokale Artikelnummer:: APOSOR28120-1G
Beschreibung:   Picloram
VE:  1 * 1 g
Preis auf Anfrage
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Lager für diesen Artikel ist begrenzt, kann aber in einem Lagerhaus in Ihrer Nähe zur Verfügung. Bitte stellen Sie sicher, dass Sie in sind angemeldet auf dieser Seite, so dass verfügbare Bestand angezeigt werden können. Wenn das call noch angezeigt wird und Sie Hilfe benötigen, rufen Sie uns an 1-800-932 - 5000.
Dieses Produkt kann nur an eine Lieferadresse versandt werden die über die entsprechende Lizenzen verfügt. Für weitere Hilfe bitte kontaktieren Sie Ihr VWR Vertriebszentrum.
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
Dieses Produkt wurde von Ihrer Organisation gesperrt. Bitte kontaktieren Sie Ihren Einkauf für weitere Informationen.
Dieses Produkt ist Ersatz für den von Ihnen gewünschten Artikel.
Dieses Produkt ist nicht mehr verfügbar. Bitte kontaktieren Sie den VWR Kundenservice.
4 497 - 4 512  von 174 131